anti-beta Tubulin 2A Antibody ABIN631482 from antibodies-online

Description

Product Characteristics: TUBB2A belongs to the tubulin family. Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain.
Target Information: Please see product details or send an inquiry to antibodies-online for additional target information

Product Specs
Itemanti-beta Tubulin 2A Antibody
Companyantibodies-online
Price Pricing Info Supplier Page View Company Product Page
Catalog NumberABIN631482
ApplicationsWestern Blotting
ConcentrationLot specific
Conjugate/TagUnconjugated
FormatLyophilized
ReactivityArabidopsis,Drosophila melanogaster,Human,Mouse,Rat
Targetbeta Tubulin 2A
HostRabbit
Antibody TypePrimary
ImmunogenBeta Tubulin 2 A antibody was raised using the middle region of TUBB2 corresponding to a region with amino acids AVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAAC
ClonalityPolyclonal
Research AreaCell Biology
NCBI Full Gene Namebeta-Tubulin at 85D
NCBI Gene Aliases2t, B2t, BETA 85D, BETA2, BetaTub85D, Betatub85D, CG9359, D.m.BETA-85D, DTB4, Dmbeta2, Dmel\CG9359, Tub, Tub2A, beta(2)Tu, beta(2)Tub, beta-Tub85D, beta-tub, beta-tub85D, beta2, beta2-tub, beta2t, beta2tub, beta85D, beta;Tub85D, betaTub, betaTub2, beta[[2]]-tubulin, betatub85D, ms(3)KK[D]
Quantity100 µL